Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Adenylate Kinase 6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Adenylate Kinase 6 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Adenylate Kinase 6 Polyclonal specifically detects Adenylate Kinase 6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Adenylate Kinase 6 | |
Polyclonal | |
Rabbit | |
Human | |
AD-004, Adenylate kinase isoenzyme 6, adrenal gland protein AD-004, AK/ATPase, AK6, ATP-AMP transphosphorylase 6, CGI-137, CINAP, CIP, coilin interacting nuclear ATPase protein, coilin interacting protein, Coilin-interacting nuclear ATPase protein, Dual activity adenylate kinase/ATPase, EC=2.7.4.3, hCINAP | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
AK6 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title