Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Adenylosuccinate Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$254.28 - $665.36

Specifications

Antigen	Adenylosuccinate Synthase
Concentration	0.05mg/mL
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB430373 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19036025UL	25 μL	Each for $254.28	Only null left	Sign In or Register to check your price. Add to Cart

NBP190360 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP190360	0.1 mL	Each for $665.36	Only null left	Sign In or Register to check your price. Add to Cart

Description

Adenylosuccinate Synthase Polyclonal specifically detects Adenylosuccinate Synthase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	Adenylosuccinate Synthase
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Lipid and Metabolism
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ADEH, adenylosuccinate synthase, adenylosuccinate synthetase (Ade(-)H-complementing), adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, AdSS 2, ADSS2, AMPSase 2, EC 6.3.4.4, IMP--aspartate ligase 2, L-type adenylosuccinate synthetase, MGC20404
Gene Symbols	ADSS2
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Concentration	0.05mg/mL
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Accession No.	P30520
Gene ID (Entrez)	159
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Molecular Weight of Antigen	50 kDa

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Adenylosuccinate Synthase Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents