Adenylosuccinate Synthase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310839100UL

Catalog No. NB126579

Description

Adenylosuccinate Synthase Polyclonal specifically detects Adenylosuccinate Synthase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Adenylosuccinate Synthase
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ADEH, adenylosuccinate synthase, adenylosuccinate synthetase (Ade(-)H-complementing), adenylosuccinate synthetase isozyme 2, Adenylosuccinate synthetase, acidic isozyme, Adenylosuccinate synthetase, liver isozyme, AdSS 2, ADSS2, AMPSase 2, EC 6.3.4.4, IMP--aspartate ligase 2, L-type adenylosuccinate synthetase, MGC20404
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Adenylosuccinate Synthase (NP_031448.2). Peptide sequence GWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYS
• Quantity: 100 μg
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 159
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified