Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23825125UL
Description
ADI1 Polyclonal specifically detects ADI1 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ADI1 | |
Polyclonal | |
Western Blot 0.4 μg/mL, Simple Western 1:25, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q9BV57 | |
ADI1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: FYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEAR | |
25 μL | |
metabolism, Signal Transduction | |
55256 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, Acireductone dioxygenase (Ni(2+)-requiring), acireductone dioxygenase 1, APL1, ARDsubmergence induced protein 2, EC 1.13.11.53, FLJ10913, HMFT1638, membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1, Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1, MTCBP1, MTCBP-1, Ni-ARD, SIPLMT1-MMP cytoplasmic tail-binding protein-1, Submergence-induced protein 2 homolog | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction