Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADPRHL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18883525UL
Description
ADPRHL2 Polyclonal specifically detects ADPRHL2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
ADPRHL2 | |
Polyclonal | |
Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
[Protein ADP-ribosylarginine] hydrolase-like protein 2, ADP-ribosylhydrolase 3, ADP-ribosylhydrolase like 2, ARH3EC 3.2.1.143, FLJ20446, poly(ADP-ribose) glycohydrolase ARH3, protein ADP-ribosylarginine hydrolase-like protein 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human ADPRHL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ADPRHL2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR | |
25 μL | |
DNA replication Transcription Translation and Splicing | |
54936 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction