ADSSL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325267

Catalog No. NB301185

Description

ADSSL1 Polyclonal antibody specifically detects ADSSL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ADSSL1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: adenylosuccinate synthase like 1, adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, ADSL1, AdSS 1, ADSS1, AMPSase 1, EC 6.3.4.4, FLJ38602, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ADSSL1 using the following amino acid sequence: DILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVG
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 122622
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified