Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Advillin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180007
Description
Advillin Polyclonal specifically detects Advillin in Human samples. It is validated for Western Blot.Specifications
Advillin | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ADVIL, advillin, DOC6, FLJ12386, MGC133244, p92DKFZp779O1812 | |
Rabbit | |
60 kDa | |
100 μL | |
Neuroscience | |
10677 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O75366 | |
AVIL | |
Synthetic peptide directed towards the middle region of human AVIL (NP_006567). Peptide sequence: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction