Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AE2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159858
Description
AE2 Polyclonal specifically detects AE2 in Human, Mouse, Rat samples. It is validated for Western Blot.Specifications
AE2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
AE 2, AE2anion exchanger 2 type a, Anion exchanger 2, anion exchanger 2 type b2, BND3LHKB3anion exchange protein 2, EPB3L1anion exchanger 2 type b1, FLJ59028, MPB3L, NBND3, Non-erythroid band 3-like protein, Solute carrier family 4 member 2, solute carrier family 4, anion exchanger, member 2 (erythrocyte membraneprotein band 3-like 1) | |
Rabbit | |
137 kDa | |
100 μL | |
Primary | |
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P04920 | |
SLC4A2 | |
Synthetic peptides corresponding to SLC4A2(solute carrier family 4, anion exchanger, member 2) Antibody(against the N terminal of SLC4A2 (NP_003031). Peptide sequence MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI. | |
Affinity purified | |
RUO | |
6522 | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction