Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AE2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$548.00

Specifications

Antigen	AE2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159858 View Documents View Product Certificates	Novus Biologicals NBP159858	100 μL	Each of 1 for $548.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

AE2 Polyclonal specifically detects AE2 in Human, Mouse, Rat samples. It is validated for Western Blot.

Specifications

Antigen	AE2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	P04920
Gene ID (Entrez)	6522
Immunogen	Synthetic peptides corresponding to SLC4A2(solute carrier family 4, anion exchanger, member 2) Antibody(against the N terminal of SLC4A2 (NP_003031). Peptide sequence MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	AE 2, AE2anion exchanger 2 type a, Anion exchanger 2, anion exchanger 2 type b2, BND3LHKB3anion exchange protein 2, EPB3L1anion exchanger 2 type b1, FLJ59028, MPB3L, NBND3, Non-erythroid band 3-like protein, Solute carrier family 4 member 2, solute carrier family 4, anion exchanger, member 2 (erythrocyte membraneprotein band 3-like 1)
Gene Symbols	SLC4A2
Isotype	IgG
Molecular Weight of Antigen	137 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

AE2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents