AF10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325268

Catalog No. NB301184

Description

AF10 Polyclonal antibody specifically detects AF10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: AF10
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: AF10MGC75086, ALL1-fused gene from chromosome 10 protein, DKFZp686E10210, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog),translocated to, 10, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila),translocated to, 10, protein AF-10, type I AF10 protein
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein AF10 using the following amino acid sequence: IVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSM
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8028
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG