Aggrecan Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25553925UL

Catalog No. NB394955

Description

Aggrecan Polyclonal specifically detects Aggrecan in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aggrecan
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: AGC1SEDK, aggrecan, aggrecan core protein, Cartilage-specific proteoglycan core protein, Chondroitin sulfate proteoglycan 1, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1aggrecan 1, CSPGCP, large aggregating proteoglycan, MSK16AGCAN
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ACAN
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPG
• Quantity: 25 μL
• Research Discipline: Extracellular Matrix, Growth and Development, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers
• Gene ID (Entrez): 176
• Target Species: Human
• Isotype: IgG

For Research Use Only