Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AGMO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | AGMO |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170404
![]() |
Novus Biologicals
NBP170404 |
100 μL |
Each for $487.50
|
|
|||||
NBP17040420
![]() |
Novus Biologicals
NBP17040420UL |
20 μL | N/A | N/A | N/A | ||||
Description
AGMO Polyclonal specifically detects AGMO in Human samples. It is validated for Western Blot.Specifications
AGMO | |
Polyclonal | |
Rabbit | |
alkylglycerol monooxygenase, transmembrane protein 195 | |
AGMO | |
IgG | |
51 kDa |
Western Blot | |
Unconjugated | |
RUO | |
392636 | |
Synthetic peptides corresponding to TMEM195 (transmembrane protein 195) The peptide sequence was selected from the middle region of TMEM195)(50ug). Peptide sequence AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title