Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578737

AGO1 Polyclonal Antibody, Invitrogen™

Catalog No. PIPA578737
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578737 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578737 Supplier Thermo Scientific Supplier No. PA578737

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL.

AGO1 is a member of the Argonaute family of proteins which play a role in RNA interference. The protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. AGO1 binds to miRNAs or siRNAs and represses the translation of mRNAs.
TRUSTED_SUSTAINABILITY

Specifications

Antigen AGO1
Applications Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4MG trehalose and 0.05MG sodium azide
Gene Ago1
Gene Accession No. Q8CJG1, Q9UL18
Gene Alias AGO1; argonaute 1; argonaute 1, RISC catalytic component; argonaute RISC catalytic component 1; argonaute RISC catalytic subunit 1; argonaute1; EIF2C; eIF2C 1; eIF-2C 1; EIF2C1; Eukaryotic translation initiation factor 2C 1; eukaryotic translation initiation factor 2C, 1; GERP95; Golgi Endoplasmic Reticulum protein 95 kDa; hAgo1; mAgo1; Piwi/Argonaute family protein meIF2C1; Protein argonaute-1; putative RNA-binding protein Q99; Q99
Gene Symbols Ago1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human EIF2C1/AGO1 (376-409aa EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 236511, 26523, 313594
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.