Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AGPAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | AGPAT1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
AGPAT1 Polyclonal specifically detects AGPAT1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
AGPAT1 | |
Polyclonal | |
Rabbit | |
Human | |
1-acylglycerol-3-phosphate O-acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase), 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase, alpha), 1-AGP acyltransferase 1, 1-AGPAT1, EC 2.3.1.51, G15, LPAATA, LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, Lysophosphatidic acid acyltransferase alpha, lysophospholipid acyltransferase, MGC4007,1-AGPAT 1, MGC5423, Protein G15 | |
AGPAT1 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
10554 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title