Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AGPAT7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31756725UL
This item is not returnable.
View return policy
Description
AGPAT7 Polyclonal antibody specifically detects AGPAT7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
AGPAT7 | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
acyltransferase like 3, Acyltransferase-like 3, AGPAT7acyl-CoA:lysophosphatidylethanolamine acyltransferase 2, AYTL3lysophospholipid acyltransferase LPCAT4,1-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acidacyltransferase, eta), EC 2.3.1, EC 2.3.1.-, EC 2.3.1.23, FLJ10257,1-acylglycerol-3-phosphate O-acyltransferase 7, LPAAT-eta, LPEAT21-AGPAT 7, lysophosphatidylcholine acyltransferase 41-AGP acyltransferase 7, Lysophosphatidylethanolamine acyltransferase 2, PLSC domain containing protein | |
This antibody was developed against Recombinant Protein corresponding to amino acids: ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEFARQLQLSDPQTVAGAFGYFQQDT | |
25 μg | |
Lipid and Metabolism | |
254531 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction