AGXT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP189200

Catalog No. NBP189200

Description

AGXT Polyclonal specifically detects AGXT in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AGXT
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Simple Western 1:20, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000-1:2500
• Gene Accession No.: P21549
• Gene Symbols: AGXT
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human AGXT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AGT1L-alanine: glyoxylate aminotransferase 1, AGThepatic peroxisomal alanine:glyoxylate aminotransferase, AGXT1, alanine-glyoxylate aminotransferase, Alanine--glyoxylate aminotransferase, EC 2.6.1.44, EC 2.6.1.51, PH1, serine:pyruvate aminotransferase, SPATserine-pyruvate aminotransferase, SPTserine--pyruvate aminotransferase, TLH6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 189
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only