AGXT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179303

Catalog No. NBP179303

Description

AGXT2 Polyclonal specifically detects AGXT2 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: AGXT2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: (R)-3-amino-2-methylpropionate--pyruvate transaminase, AGT 2, alanine-glyoxylate aminotransferase 2, alanine--glyoxylate aminotransferase 2, Beta-ALAAT II, Beta-alanine-pyruvate aminotransferase, DAIBAT, D-AIBAT, EC 2.6.1.40, EC 2.6.1.44, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64902
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_114106
• Gene Symbols: AGXT2
• Immunogen: Synthetic peptide directed towards the N terminal of human AGXT2The immunogen for this antibody is AGXT2. Peptide sequence TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 78%; Rabbit: 78%; Rat: 78%; Mouse: 76%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Equine, Rabbit
• Isotype: IgG

For Research Use Only