Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AGXT2L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | AGXT2L1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
AGXT2L1 Polyclonal specifically detects AGXT2L1 in Human samples. It is validated for Western Blot.Specifications
AGXT2L1 | |
Polyclonal | |
Rabbit | |
Q8TBG4 | |
64850 | |
Synthetic peptides corresponding to AGXT2L1(alanine-glyoxylate aminotransferase 2-like 1) The peptide sequence was selected from the middle region of AGXT2L1. Peptide sequence KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
alanine--glyoxylate aminotransferase 2-like 1, alanine-glyoxylate aminotransferase 2-like 1, EC 2.6.1, EC 2.6.1.-, EC 2.6.1.11, EC 2.6.1.44 | |
AGXT2L1 | |
IgG | |
56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title