Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AKD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | AKD1 |
---|---|
Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
AKD1 Polyclonal specifically detects AKD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
AKD1 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q5TCS8 | |
221264 | |
This antibody was developed against a recombinant protein corresponding to amino acids: VVTMIEETIKMSQDINFEQPYEKHAEILQEVLGEVMEENKDRFPGAPKYGGWIVDNCPIVKELWMALIKKGIIPDLVIYLSDTENNGK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
adenylate kinase domain containing 1, adenylate kinase domain containing 2, adenylate kinase domain-containing protein 1, Adenylate kinase domain-containing protein 2, AKD2, C6orf199, C6orf224, chromosome 6 open reading frame 199, chromosome 6 open reading frame 224, dJ70A9.1, FLJ16163, FLJ25791, FLJ34784, FLJ42177, MGC126763, MGC138153, MGC177059, MGC180194, MGC184281, MGC26954, RP1-70A9.1 | |
AK9 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title