Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595612

Invitrogen™ AKR1D1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595612
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595612 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595612 Supplier Invitrogen™ Supplier No. PA595612
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human CACO-2 whole cell, rat liver tissue, mouse liver tissue. Flow: HepG2 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction.
TRUSTED_SUSTAINABILITY

Specifications

Antigen AKR1D1
Applications Flow Cytometry, Western Blot, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene AKR1D1
Gene Accession No. P31210, P51857, Q8VCX1
Gene Alias 3o5bred; 3-oxo-5-beta-steroid 4-dehydrogenase; Akr1d1; Aldo-keto reductase family 1 member D1; aldo-keto reductase family 1, member D1; aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase); CBAS2; delta 4-3-ketosteroid-5-beta-reductase; delta(4)-3-ketosteroid 5-beta-reductase; Delta(4)-3-oxosteroid 5-beta-reductase; SRD5B1; steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1)
Gene Symbols AKR1D1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human AKR1D1 (EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 192242, 208665, 6718
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.