Invitrogen™ AKR1D1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595612

Catalog No. PIPA595612

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human CACO-2 whole cell, rat liver tissue, mouse liver tissue. Flow: HepG2 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction.

Specifications

• Antigen: AKR1D1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: AKR1D1
• Gene Alias: 3o5bred; 3-oxo-5-beta-steroid 4-dehydrogenase; Akr1d1; Aldo-keto reductase family 1 member D1; aldo-keto reductase family 1, member D1; aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase); CBAS2; delta 4-3-ketosteroid-5-beta-reductase; delta(4)-3-ketosteroid 5-beta-reductase; Delta(4)-3-oxosteroid 5-beta-reductase; SRD5B1; steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1)
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 192242, 208665, 6718
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P31210, P51857, Q8VCX1
• Gene Symbols: AKR1D1
• Immunogen: A synthetic peptide corresponding to a sequence of human AKR1D1 (EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG