AKR7A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25650925UL

Catalog No. NB394452

Description

AKR7A2 Polyclonal specifically detects AKR7A2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: AKR7A2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: AFAR1, AFARAFB1-AR1, AFB1 aldehyde reductase 1, AFB1-AR 1, aflatoxin B1 aldehyde reductase member 2, aflatoxin beta1 aldehyde reductase, AKR7, aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase), Aldoketoreductase 7, EC 1.1.1.n11, SSA reductase, Succinic semialdehyde reductase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8574
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AKR7A2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only