Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AKT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | AKT2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AKT2 Polyclonal specifically detects AKT2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| AKT2 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Autophagy, Cancer, Growth and Development, Hypoxia, mTOR Pathway, Neuronal Cell Markers, Protein Kinase, Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 208 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.11, EC 2.7.11.1, Murine thymoma viral (v-akt) homolog-2, PKB beta, PKBB, PKBBETA, PRKBB, Protein kinase Akt-2, Protein kinase B beta, rac protein kinase beta, RAC-BETA, RAC-beta serine/threonine-protein kinase, RAC-PK-beta, v-akt murine thymoma viral oncogene homolog 2 | |
| AKT2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title