Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALAD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$382.00 - $646.00

Specifications

Antigen	ALAD
Dilution	Western Blot 0.4 ug/ml, Simple Western 1:200, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB430881 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18915825UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

NBP189158 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP189158	0.1 mL	Each for $646.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

ALAD Polyclonal specifically detects ALAD in Human, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	ALAD
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Rat
Gene Alias	ALADHEC 4.2.1.24, aminolevulinate dehydratase, aminolevulinate, delta-, dehydratase, delta-aminolevulinic acid dehydratase, PBGSMGC5057, Porphobilinogen synthase
Gene Symbols	ALAD
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of human ALAD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Western Blot 0.4 ug/ml, Simple Western 1:200, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Proteases & Other Enzymes
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	210
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:GCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ALAD Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents