Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALAS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ALAS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15472620
|
Novus Biologicals
NBP15472620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP154726
|
Novus Biologicals
NBP154726 |
100 μL |
Each for $487.50
|
|
|||||
Description
ALAS2 Polyclonal specifically detects ALAS2 in Human samples. It is validated for Western Blot.Specifications
| ALAS2 | |
| Polyclonal | |
| Rabbit | |
| P22557 | |
| 212 | |
| Synthetic peptides corresponding to ALAS2(aminolevulinate, delta-, synthase 2) The peptide sequence was selected from the N terminal of ALAS2. Peptide sequence CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 5-aminolevulinic acid synthase 2,5-aminolevulinate synthase, erythroid-specific, mitochondrial, ALASE, ALAS-E, aminolevulinate, delta-, synthase 2, aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia), ANH1, ASBXLDPP, Delta-ALA synthase 2, delta-ALA synthetase, Delta-aminolevulinate synthase 2, EC 2.3.1.37, FLJ93603, XLSA | |
| ALAS2 | |
| IgG | |
| 60 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title