Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
alcohol dehydrogenase 1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | alcohol dehydrogenase 1A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157672
|
Novus Biologicals
NBP157672 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
alcohol dehydrogenase 1A Polyclonal specifically detects alcohol dehydrogenase 1A in Human samples. It is validated for Western Blot.Specifications
alcohol dehydrogenase 1A | |
Polyclonal | |
Rabbit | |
P07327 | |
124 | |
Synthetic peptides corresponding to ADH1A(alcohol dehydrogenase 1A (class I), alpha polypeptide) The peptide sequence was selected from the N terminal of ADH1A. Peptide sequence NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1 | |
ADH1A | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title