alcohol dehydrogenase 1A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310788100UL

Catalog No. NB126477

Description

alcohol dehydrogenase 1A Polyclonal specifically detects alcohol dehydrogenase 1A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: alcohol dehydrogenase 1A
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ADH, alpha subunit, ADH1alcohol dehydrogenase 1A, alcohol dehydrogenase 1 (class I), alpha polypeptide, alcohol dehydrogenase 1A (class I), alpha polypeptide, Alcohol dehydrogenase subunit alpha, aldehyde reductase, EC 1.1.1, EC 1.1.1.1
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human alcohol dehydrogenase 1A. Peptide sequence PESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDEN
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 124
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.