alcohol dehydrogenase 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP23063625UL

Catalog No. NB397694

Description

alcohol dehydrogenase 5 Polyclonal specifically detects alcohol dehydrogenase 5 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: alcohol dehydrogenase 5
• Classification: Polyclonal
• Dilution: Western Blot, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P11766
• Gene Symbols: ADH5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG
• Quantity: 25 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 128
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ADH-3, ADHXEC 1.1.1.1, alcohol dehydrogenase (class III), chi polypeptide, Alcohol dehydrogenase 5, alcohol dehydrogenase 5 (class III), chi polypeptide, Alcohol dehydrogenase class chi chain, alcohol dehydrogenase class-3, Alcohol dehydrogenase class-III, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.284, FALDH, FDHGSNOR, formaldehyde dehydrogenase, Glutathione-dependent formaldehyde dehydrogenase, GSH-FDH, S-(hydroxymethyl)glutathione dehydrogenase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only