alcohol dehydrogenase 7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP190232

Catalog No. NBP190232

Description

alcohol dehydrogenase 7 Polyclonal specifically detects alcohol dehydrogenase 7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: alcohol dehydrogenase 7
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: ADH4, ADH-4, alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide, alcohol dehydrogenase class 4 mu/sigma chain, Alcohol dehydrogenase class IV mu/sigma chain, alcohol dehydrogenase VII, alcohol dehydrogenase-7, class IV sigma-1 alcohol dehydrogenase, class IV sigmasigma alcohol dehydrogenase, EC 1.1.1, EC 1.1.1.1, Gastric alcohol dehydrogenase, Retinol dehydrogenase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 131
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ADH7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human alcohol dehydrogenase 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only