Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255797

Catalog No. NBP255797

Description

Aldehyde Dehydrogenase 3-A1/ALDH3A1 Polyclonal specifically detects Aldehyde Dehydrogenase 3-A1/ALDH3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aldehyde Dehydrogenase 3-A1/ALDH3A1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC 1.2.1.5, MGC10406, stomach aldehyde dehydrogenase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ALDH3A1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL
• Quantity: 100 μL
• Research Discipline: Vision
• Gene ID (Entrez): 218
• Target Species: Human
• Isotype: IgG

For Research Use Only