Invitrogen™ ALDH1B1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595376

Catalog No. PIPA595376

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human K562 whole cell, human A431 whole cell, human A549 whole cell, human U20S whole cell, human Hela whole cell, monkey COS-7 whole cell, rat liver tissue, rat testis tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue. IHC: human colon cancer tissue, human colonic adenocarcinoma tissue, human endometrial adenocarcinoma tissue, human hepatocellular carcinoma tissue, human laryngeal squamous cell carcinoma tissue, mouse colon tissue, rat colon tissue. ICC/IF: A431 cell. Flow: HEL cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Aldehyde dehydrogenases (ALDHs) mediate NADP+-dependent oxidation of aldehydes into acids during detoxification of alcohol-derived acetaldehyde, lipid peroxidation and metabolism of corticosteroids, biogenic amines and neurotransmitters. Alcohol drinking habits and cardiovascular disease risk factors may be associated with ALDH gene variants. ALDH1B1 (Aldehyde dehydrogenase family 1 member B1), also known as ALDH5 or ALDHX (Aldehyde dehydrogenase X, mitochondrial), is a 517 amino acid mitochondrial protein that is expressed in the liver, testis and to a lesser extent in brain. ALDH1B1 belongs to the aldehyde dehydrogenase family and may play a major role in ethanol detoxification.

Specifications

• Antigen: ALDH1B1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ALDH1B1
• Gene Alias: 2700007F14Rik; acetaldehyde dehydrogenase 5; aldehyde dehydrogenase 1 family member B1; aldehyde dehydrogenase 1 family, member B1; aldehyde dehydrogenase 1B1; aldehyde dehydrogenase 5; Aldehyde dehydrogenase family 1 member B1; aldehyde dehydrogenase X, mitochondrial; ALDH class 2; ALDH1B1; ALDH5; ALDHX; MGC2230
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 219, 298079, 72535
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P30837, Q66HF8, Q9CZS1
• Gene Symbols: ALDH1B1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat, Monkey
• Product Type: Antibody
• Isotype: IgG