Invitrogen™ ALDH2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578757

Catalog No. PIPA578757

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Kidney Tissue, Mouse Kidney Tissue. IHC: rat liver tissue, human kidney cancer tissue. ICC/IF: U20S cell.

ALDH2 belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Asians have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Asians than among Caucasians could be related to the absence of the mitochondrial isozyme.

Specifications

• Antigen: ALDH2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Aldh2
• Gene Alias: acetaldehyde dehydrogenase 2; Ahd1; Ahd-1; Ahd5; Ahd-5; AHD-M1; aldehyde dehydrogenase 2 family (mitochondrial); aldehyde dehydrogenase 2, mitochondrial; aldehyde dehydrogenase, mitochondrial; ALDH class 2; ALDH1; ALDH2; ALDH-E2; ALDHI; ALDM; EC 1.2.1.3; liver mitochondrial ALDH; MGC1806; mitochondrial aldehyde dehydrogenase; nucleus-encoded mitochondrial aldehyde dehydrogenase 2
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11669, 217, 29539
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5 mg BSA and 0.05 mg sodium azide
• Gene Accession No.: P05091, P11884, P47738
• Gene Symbols: Aldh2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG