Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aldo-keto Reductase 1B10/AKR1B10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18916125UL
Description
Aldo-keto Reductase 1B10/AKR1B10 Polyclonal specifically detects Aldo-keto Reductase 1B10/AKR1B10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Aldo-keto Reductase 1B10/AKR1B10 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
AKR1B11, AKR1B12, aldo-keto reductase family 1 member B10, aldo-keto reductase family 1, member B10 (aldose reductase), aldo-keto reductase family 1, member B11 (aldose reductase-like), Aldose reductase-like, aldose reductase-like 1, aldose reductase-like peptide, Aldose reductase-related protein, ALDRLn, ARL1, ARL-1SI reductase, ARP, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.21, hARP, HIS, HSI, MGC14103, Small intestine reductase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
AKR1B10 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT | |
25 μL | |
Cancer, Lipid and Metabolism | |
57016 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction