Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Aldo-keto Reductase 1B10/AKR1B10 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7234290 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB126583 100 μg
NB126584 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB126583 Supplier Novus Biologicals Supplier No. NBP310841100UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Aldo-keto Reductase 1B10/AKR1B10 Polyclonal specifically detects Aldo-keto Reductase 1B10/AKR1B10 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Aldo-keto Reductase 1B10/AKR1B10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias AKR1B11, AKR1B12, aldo-keto reductase family 1 member B10, aldo-keto reductase family 1, member B10 (aldose reductase), aldo-keto reductase family 1, member B11 (aldose reductase-like), Aldose reductase-like, aldose reductase-like 1, aldose reductase-like peptide, Aldose reductase-related protein, ALDRLn, ARL1, ARL-1SI reductase, ARP, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.21, hARP, HIS, HSI, MGC14103, Small intestine reductase
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Aldo-keto Reductase 1B10/AKR1B10 (NP_032038.1). Peptide sequence TNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLED
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 57016
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.