Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aldo-keto Reductase 1C1/AKR1C1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP168878
Description
Aldo-keto Reductase 1C1/AKR1C1 Polyclonal specifically detects Aldo-keto Reductase 1C1/AKR1C1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Aldo-keto Reductase 1C1/AKR1C1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
20 alpha-hydroxysteroid dehydrogenase, 20-ALPHA-HSD, 20-alpha-hydroxysteroid dehydrogenase, aldo-keto reductase family 1 member C1, aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase), C9, Chlordecone reductase homolog HAKRC, DD1/DD2, DD1MGC8954, DDHH-37, dihydrodiol dehydrogenase 1, Dihydrodiol dehydrogenase 1/2, dihydrodiol dehydrogenase isoform DD1, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.112, EC 1.1.1.149,2-ALPHA-HSD, EC 1.3.1.20, HAKRCDDH1aldo-keto reductase C, HBAB, hepatic dihydrodiol dehydrogenase, High-affinity hepatic bile acid-binding protein, Indanol dehydrogenase, MBAB, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II 3-alpha-hydroxysteroid dehydrogenase | |
Rabbit | |
36 kDa | |
100 μL | |
metabolism | |
1645 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
Q04828 | |
AKR1C1 | |
Synthetic peptide directed towards the N terminal of human AKR1C1. Peptide sequence: LERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATW | |
Affinity purified | |
RUO | |
Primary | |
Bovine: 86%; Rat: 82%; Canine: 77%; Porcine: 77%; Equine: 77%. | |
Human, Rat, Pig, Bovine, Canine, Equine, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction