Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Aldo-keto Reductase 1C1/AKR1C1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen Aldo-keto Reductase 1C1/AKR1C1
Immunogen Synthetic peptide directed towards the N terminal of human AKR1C1 (NP_001344). Peptide sequence: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16887720 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16887720UL
20ul Each for $149.00
Add to cart
 
NBP168877 View Documents Novus BiologicalsSupplier Diversity Partner
NBP168877
100 ul Each for $329.00
Add to cart
 
Description

Description

Aldo-keto Reductase 1C1/AKR1C1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

Aldo-keto Reductase 1C1/AKR1C1
Rabbit
Polyclonal
Unconjugated
1645
Affinity Purified
Western Blot, Immunohistochemistry
RUO
Synthetic peptide directed towards the N terminal of human AKR1C1 (NP_001344). Peptide sequence: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL
Primary
IgG
20 alpha-hydroxysteroid dehydrogenase, 20-ALPHA-HSD, 20-alpha-hydroxysteroid dehydrogenase, aldo-keto reductase family 1 member C1, aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase), C9, Chlordecone reductase homolog HAKRC, DD1/DD2, DD1MGC8954, DDHH-37, dihydrodiol dehydrogenase 1, Dihydrodiol dehydrogenase 1/2, dihydrodiol dehydrogenase isoform DD1, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.112, EC 1.1.1.149,2-ALPHA-HSD, EC 1.3.1.20, HAKRCDDH1aldo-keto reductase C, HBAB, hepatic dihydrodiol dehydrogenase, High-affinity hepatic bile acid-binding protein, Indanol dehydrogenase, MBAB, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II 3-alpha-hydroxysteroid dehydrogenase
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit