Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP214281

ALG10 Antibody, Novus Biologicals™
SDP

Catalog No. NBP214281 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP214281 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP214281 Supplier Novus Biologicals Supplier No. NBP214281
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ALG10 Polyclonal specifically detects ALG10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen ALG10
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q5BKT4
Gene Alias ALG10A, alpha-1,2-glucosyltransferase ALG10-A, alpha-1,2-glucosyltransferase), alpha2-glucosyltransferase, Alpha-2-glucosyltransferase ALG10-A, asparagine-linked glycosylation 10 homolog (yeast, asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S.pombe), asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog(yeast), Asparagine-linked glycosylation protein 10 homolog A, derepression of ITR1 expression 2 homolog, DIE2, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.16, FLJ14751, KCR1, potassium channel regulator 1
Gene Symbols ALG10
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84920
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.