Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALG10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP214281
Description
ALG10 Polyclonal specifically detects ALG10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ALG10 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q5BKT4 | |
ALG10 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ALG10A, alpha-1,2-glucosyltransferase ALG10-A, alpha-1,2-glucosyltransferase), alpha2-glucosyltransferase, Alpha-2-glucosyltransferase ALG10-A, asparagine-linked glycosylation 10 homolog (yeast, asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S.pombe), asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog(yeast), Asparagine-linked glycosylation protein 10 homolog A, derepression of ITR1 expression 2 homolog, DIE2, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.16, FLJ14751, KCR1, potassium channel regulator 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
84920 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction