Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALG1L6P Antibody, Novus Biologicals™
SDP

Catalog No. NBP170606 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP170606 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP170606 Supplier Novus Biologicals Supplier No. NBP170606

Rabbit Polyclonal Antibody

ALG1L6P Polyclonal specifically detects ALG1L6P in Human samples. It is validated for Western Blot.

Specifications

Antigen ALG1L6P
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias asparagine-linked glycosylation 1-like 6, pseudogene, LOC339879 asparagine-linked glycosylation 1 homolog pseudogene
Gene Symbols ALG1L6P
Host Species Rabbit
Immunogen Synthetic peptides corresponding to LOC339879(hypothetical LOC339879) The peptide sequence was selected from the C terminal of LOC339879. Peptide sequence HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 339879
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Sumatran orangutan: 92%; White-tufted-ear marmoset: 85%; Canine: 84%; Mouse: 80%; Rat: 78%; Zebrafish: 78%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Canine, Guinea Pig, Zebrafish
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.