ALK-1 Rabbit anti-Human, Mouse, Rat, Clone: 8L2V7, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP316876100UL

Catalog No. NB168840

Description

ALK-1 Monoclonal antibody specifically detects ALK-1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: ALK-1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Clone: 8L2V7
• Dilution: Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: activin A receptor type II-like 1, activin A receptor, type II-like kinase 1, Activin receptor-like kinase 1, ACVRLK1ORW2, ALK-1, ALK1TGF-B superfamily receptor type I, EC 2.7.11, HHT, HHT2EC 2.7.11.30, serine/threonine-protein kinase receptor R3, SKR3, TSR-I
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 404-503 of human ALK-1 (P37023). VLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPKVIQ
• Quantity: 100 μg
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 94
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG