Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Alkaline Phosphatase/ALPP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	Alkaline Phosphatase/ALPP
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB397267 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23405625UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP234056 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP234056	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Alkaline Phosphatase/ALPP Polyclonal specifically detects Alkaline Phosphatase/ALPP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	Alkaline Phosphatase/ALPP
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	P05187
Gene ID (Entrez)	250
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: NWYSDADVPASARQEGCQDIATQLISNMDI
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cancer, Embryonic Stem Cell Markers, Ovarian Carcinoma Cell Markers, Stem Cell Markers
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental, alkaline phosphatase, placental (Regan isozyme), alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, EC 3.1.3.1, FLJ61142, glycerophosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1, Regan isozyme
Gene Symbols	ALPP
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Alkaline Phosphatase/ALPP Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents