Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP157907

Alkaline Phosphatase/ALPP Antibody, Novus Biologicals™
SDP

Catalog No. NBP157907 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157907 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157907 Supplier Novus Biologicals Supplier No. NBP157907
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Alkaline Phosphatase/ALPP Polyclonal specifically detects Alkaline Phosphatase/ALPP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Alkaline Phosphatase/ALPP
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P05187
Gene Alias Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental, alkaline phosphatase, placental (Regan isozyme), alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, EC 3.1.3.1, FLJ61142, glycerophosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1, Regan isozyme
Gene Symbols ALPP
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ALPP(alkaline phosphatase, placental (Regan isozyme)) The peptide sequence was selected from the C terminal of ALPP (NP_001623). Peptide sequence TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA.
Molecular Weight of Antigen 59 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Embryonic Stem Cell Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 250
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Xenopus: 85%; Canine: 85%; Western clawed frog: 85%; Green puffer: 85%; Yellowfever mosquito: 84%; Shewanella baltica BA175: 84%; Shewanella baltica OS183: 84%; Shewanella baltica OS678: 84%; Shewanella benthica KT99: 84%; Pseudoalteromonas tunicata D2: 84%; Alteromonadales bacterium TW-7: 84%; Sea squirt: 78%; Chicken: 78%; Zebrafish: 78%; Mouse: 78%; Atlantic cod: 78%; Rat: 78%; Silk moth: 78%; Wild silk moth: 78%; Bovine: 78%; Florida lancelet: 78%; Savannah tsetse fly: 78%; Congregibacter litoralis KT71: 76%; Black-legged tick: 76%; Red flour beetle: 76%; Gamma proteobacterium HTCC2207: 76%; Fruit fly: 76%; Encephalitis mosquito: 75%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.