Alkaline Phosphatase/ALPP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157907

Catalog No. NBP157907

Description

Alkaline Phosphatase/ALPP Polyclonal specifically detects Alkaline Phosphatase/ALPP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Alkaline Phosphatase/ALPP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental, alkaline phosphatase, placental (Regan isozyme), alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, EC 3.1.3.1, FLJ61142, glycerophosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1, Regan isozyme
• Host Species: Rabbit
• Molecular Weight of Antigen: 59 kDa
• Quantity: 100 μL
• Research Discipline: Embryonic Stem Cell Markers, Stem Cell Markers
• Gene ID (Entrez): 250
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P05187
• Gene Symbols: ALPP
• Immunogen: Synthetic peptides corresponding to ALPP(alkaline phosphatase, placental (Regan isozyme)) The peptide sequence was selected from the C terminal of ALPP (NP_001623). Peptide sequence TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Xenopus: 85%; Canine: 85%; Western clawed frog: 85%; Green puffer: 85%; Yellowfever mosquito: 84%; Shewanella baltica BA175: 84%; Shewanella baltica OS183: 84%; Shewanella baltica OS678: 84%; Shewanella benthica KT99: 84%; Pseudoalteromonas tunicata D2: 84%; Alteromonadales bacterium TW-7: 84%; Sea squirt: 78%; Chicken: 78%; Zebrafish: 78%; Mouse: 78%; Atlantic cod: 78%; Rat: 78%; Silk moth: 78%; Wild silk moth: 78%; Bovine: 78%; Florida lancelet: 78%; Savannah tsetse fly: 78%; Congregibacter litoralis KT71: 76%; Black-legged tick: 76%; Red flour beetle: 76%; Gamma proteobacterium HTCC2207: 76%; Fruit fly: 76%; Encephalitis mosquito: 75%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only