Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Alkaline Phosphatase, Intestinal Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23405725UL
Description
Alkaline Phosphatase, Intestinal Polyclonal specifically detects Alkaline Phosphatase, Intestinal in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Alkaline Phosphatase, Intestinal | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
P09923 | |
ALPI | |
This antibody was developed against a recombinant protein corresponding to amino acids: HRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVE | |
25 μL | |
Cancer, Embryonic Stem Cell Markers, Lipid and Metabolism, Protein Phosphatase, Stem Cell Markers | |
248 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
alkaline phosphatase, intestinal, alkaline phosphomonoesterase, EC 3.1.3.1, glycerophosphatase, IAP, Intestinal alkaline phosphatase, intestinal-type alkaline phosphatase, Kasahara isozyme | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction