Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578760

Invitrogen™ ALOX12 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578760
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578760 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578760 Supplier Invitrogen™ Supplier No. PA578760
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat spleen tissue, mouse spleen tissue.

The ALOX12 gene encodes the enzyme arachidonate 12-lipoxygenase, a member of the lipoxygenase family that metabolizes arachidonic acid into bioactive lipid mediators. ALOX12 catalyzes the formation of 12-hydroperoxyeicosatetraenoic acid (12-HPETE), which is further reduced to 12-hydroxyeicosatetraenoic acid (12-HETE). These products are involved in various biological processes, including inflammation, cellular signaling, and blood platelet function. ALOX12 plays a significant role in pathophysiological conditions such as cancer, cardiovascular diseases, and inflammatory disorders. Dysregulation or altered expression of ALOX12 has been implicated in tumorigenesis and metastasis, where its metabolites influence cell proliferation, migration, and survival. Additionally, ALOX12 impacts platelet aggregation and inflammation, making it a potential target for therapeutic strategies aimed at treating diseases linked to lipid mediator imbalances. Research into ALOX12 continues to explore its functions in health and disease, emphasizing its importance in lipid metabolism and signaling pathways.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ALOX12
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene ALOX12
Gene Accession No. F1LQ70, P18054, P39655
Gene Alias 12(S)-lipoxygenase; 12LO; 12-LO; 12LOX; 12-LOX; 12S LOX; 12S-lipoxygenase; 12S-LOX; 9930022G08Rik; ALOX12; Alox12p; arachidonate 12-lipoxygenase; arachidonate 12-lipoxygenase, 12S type; arachidonate 12-lipoxygenase, 12S-type; Arachidonate 15-lipoxygenase,15S-type; Linoleate 13S-lipoxygenase; Lipoxin synthase 12-LO; LOG12; P-12LO; platelet 12-LOX; platelet-type 12-lipoxygenase; platelet-type lipoxygenase 12
Gene Symbols ALOX12
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11684, 239, 287454
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.