Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIMA533007

Invitrogen™ alpha Actinin 3 Monoclonal Antibody (9B5)
GREENER_CHOICE

Catalog No. PIMA533007
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA533007 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA533007 Supplier Invitrogen™ Supplier No. MA533007
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat skeletal muscle tissue, mouse skeletal muscle tissue. IHC: human skeletal muscle tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele.
TRUSTED_SUSTAINABILITY

Specifications

Antigen alpha Actinin 3
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Monoclonal
Clone 9B5
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Actn3
Gene Accession No. O88990, Q08043
Gene Alias actinin alpha 3; actinin alpha 3 (gene/pseudogene); Actinin alpha3; actinin, alpha 3; Actinin-alpha3; ACTN3; alpha-actinin skeletal muscle; Alpha-actinin skeletal muscle isoform 3; alpha-Actinin3; Alpha-actinin-3; alphaActinin-3; F-actin cross-linking protein
Gene Symbols Actn3
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11474, 171009, 89
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.