alpha-Aminoadipate Aminotransferase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB405887	Novus Biologicals NBP18962725UL	25 μL
NBP189627	Novus Biologicals NBP189627	0.1 mL

Description

alpha-Aminoadipate Aminotransferase Polyclonal specifically detects alpha-Aminoadipate Aminotransferase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: alpha-Aminoadipate Aminotransferase
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: AadAT, aminoadipate aminotransferase, EC 2.6.1.39,2-aminoadipate aminotransferase, EC 2.6.1.7,2-aminoadipate transaminase, KAT/AadAT, KAT2mitochondrial, Kynurenine aminotransferase II, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase II, L kynurenine/alpha aminoadipate aminotransferase
• Gene Symbols: AADAT
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, Neurodegeneration, Neuroscience
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 51166
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only