Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
alpha Endosulfine Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | alpha Endosulfine |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
alpha Endosulfine Polyclonal specifically detects alpha Endosulfine in Human samples. It is validated for Western Blot.Specifications
alpha Endosulfine | |
Polyclonal | |
Rabbit | |
Neuroscience | |
2029 | |
Synthetic peptides corresponding to ENSA (endosulfine alpha) The peptide sequence was selected from the N terminal of ENSA. Peptide sequence MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
alpha-endosulfine, ARPP-19eMGC4319, endosulfine alpha, MGC78563, MGC8394 | |
ENSA | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title