Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
alpha Endosulfine Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | alpha Endosulfine |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157010
|
Novus Biologicals
NBP157010 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
alpha Endosulfine Polyclonal specifically detects alpha Endosulfine in Human samples. It is validated for Western Blot.Specifications
| alpha Endosulfine | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| alpha-endosulfine, ARPP-19eMGC4319, endosulfine alpha, MGC78563, MGC8394 | |
| ENSA | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 2029 | |
| Synthetic peptides corresponding to ENSA (endosulfine alpha) The peptide sequence was selected from the N terminal of ENSA. Peptide sequence MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title