Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Alpha Fodrin Rabbit anti-Human, Mouse, Rat, Clone: 9H5V8, Novus Biologicals™

Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP316131100UL
This item is not returnable.
View return policy
Description
Alpha Fodrin Monoclonal antibody specifically detects Alpha Fodrin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Alpha Fodrin | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
9H5V8 | |
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
Alpha-II spectrin, EIEE5, FLJ17738, FLJ44613, Fodrin alpha chain, NEAS, spectrin alpha chain, brain, spectrin, alpha, non-erythrocytic 1 (alpha-fodrin), Spectrin, non-erythroid alpha chain, SPTA2 | |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alpha Fodrin (Q13813). MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIV | |
100 μg | |
Neuroscience | |
6709 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction