alpha Glucosidase 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24933225UL

Catalog No. NB395739

Description

alpha Glucosidase 2 Polyclonal antibody specifically detects alpha Glucosidase 2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: alpha Glucosidase 2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Alpha-glucosidase 2, EC 3.2.1, EC 3.2.1.84, G2ANGLUII, Glucosidase II subunit alpha, glucosidase, alpha, neutral AB, GluII, KIAA0088alpha glucosidase II alpha subunit, neutral alpha-glucosidase AB
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23193
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG