alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP288931

Catalog No. NB036521

Description

alpha-Methylacyl-CoA Racemase/AMACR Monoclonal specifically detects alpha-Methylacyl-CoA Racemase/AMACR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: alpha-Methylacyl-CoA Racemase/AMACR
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: CL9362
• Dilution: Western Blot 1 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: 2-methylacyl-CoA racemase, alpha-methylacyl-CoA racemase, CBAS4, EC 5.1.99.4, RACE, RM
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: APFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTF
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism, Prostate Cancer, Signal Transduction
• Gene ID (Entrez): 23600
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1