Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362), Novus Biologicals™
SDP

Catalog No. NB036521 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB036521 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB036521 Supplier Novus Biologicals Supplier No. NBP288931
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

alpha-Methylacyl-CoA Racemase/AMACR Monoclonal specifically detects alpha-Methylacyl-CoA Racemase/AMACR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen alpha-Methylacyl-CoA Racemase/AMACR
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL9362
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Alias 2-methylacyl-CoA racemase, alpha-methylacyl-CoA racemase, CBAS4, EC 5.1.99.4, RACE, RM
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: APFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTF
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Prostate Cancer, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23600
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.