alpha-N-terminal Methyltransferase 1A/METTL11A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258554

Catalog No. NBP258554

Description

alpha-N-terminal Methyltransferase 1A/METTL11A Polyclonal specifically detects alpha-N-terminal Methyltransferase 1A/METTL11A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: alpha-N-terminal Methyltransferase 1A/METTL11A
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AD-003, alpha N-terminal protein methyltransferase 1A, C9orf32, chromosome 9 open reading frame 32, EC 2.1.1.-, methyltransferase like 11A, Methyltransferase-like protein 11A, NRMT, N-terminal RCC1 methyltransferase, NTM1A, NTMT1, X-Pro-Lys N-terminal protein methyltransferase 1A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 28989
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NTMT1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only